| request information: |
|
| Catalog Code: | H00008723-M01 |
| Product Name: | SNX4 Antibody |
| Product Description: | Mouse Monoclonal anti-SNX4 (4H8) |
| Clone: | 4H8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8723 |
| Gene Symbol: | SNX4 |
| Omim ID: | 605931 |
| Immunogen: | SNX4 (AAH18762, 341 a.a. ~ 450 a.a) partial recombinant protein with GST tag. |
| Epitope: | QCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLK
EALISYAVMQISMCKKGIQVWTNAKECFSKM |
| Specificity: | SNX4 - sorting nexin 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein associated with the long isoform of the leptin receptor and with receptor tyrosine kinases for platelet-derived growth factor, insulin, and epidermal growth factor in cell cultures, but its function is unknown. This protein may form oligomeric complexes with family members. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |