| request information: |
|
| Catalog Code: | H00008707-M02 |
| Product Name: | UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 Antibody |
| Product Description: | Mouse Monoclonal anti-UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 (3A6) |
| Clone: | 3A6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8707 |
| Gene Symbol: | B3GALT2 |
| Omim ID: | 603018, |
| Immunogen: | B3GALT2 (NP_003774, 324 a.a. ~ 423 a.a) partial recombinant protein with GST tag. |
| Epitope: | AEKIFKVSLGIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKH
NACANAAKEKAGRYRHRKLH* |
| Specificity: | UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). This gene encodes a protein that functions in N-linked glycoprotein glycosylation and shows strict donor substrate specificity for UDP-galactose. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-BETA3GALT2 antibody, anti-GLCT2 antibody, anti-beta3Gal-T2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |