| request information: |
|
| Catalog Code: | H00008702-B01 |
| Product Name: | B4GALT4 Antibody |
| Product Description: | Mouse Polyclonal anti-B4GALT4 - UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 8702 |
| Gene Symbol: | B4GALT4 |
| Omim ID: | 604015 |
| Immunogen: | B4GALT4 (1 a.a. ~ 344 a.a) full-length human protein. |
| Epitope: | MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPS
VSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPEECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIY
VIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTA
LSREQFFKVNGFSNNYWG |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA. |
| Background: | This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene appears to mainly play a role in glycolipid biosynthesis. Two alternatively spliced transcript variants have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-B4Gal-T4 antibody, anti-beta4Gal-T4 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |