| request information: |
|
| Catalog Code: | H00008681-B01 |
| Product Name: | PLA2G4B Antibody |
| Product Description: | Mouse Polyclonal anti-PLA2G4B - phospholipase A2, group IVB (cytosolic), MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 8681 |
| Gene Symbol: | PLA2G4B |
| Immunogen: | PLA2G4B (1 a.a. ~ 316 a.a) full-length human protein. |
| Epitope: | MAEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRPCIIRNALQHWPALQKWSLPYFRATVGST
EVSVAVTPDGYADAVRGDRFMMPAERRLPLSFVLDVLEGRAQHPGVLYVQKQCSNLPSELPQLLPDLESHVPWASEALG
KMPDAVNFWLGEAAAVTSLHKDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVDEEAMEKVPW
IPLDPLAPDLARYPSYSQ |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| Background: | The LOC100137047-PLA2G4B mRNAs are naturally occurring co-transcribed products of the neighboring LOC100137047 and PLA2G4B genes. Incompletely processed read-through transcripts from these two loci are abundantly expressed in most tissues, but the function of the predicted protein product has not yet been determined. Alternative splicing of this gene results in different transcript variants, some of which are candidates for nonsense-mediated decay (NMD). |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-HsT16992 antibody, anti-cPLA2-beta antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |