| request information: |
|
| Catalog Code: | H00008671-M01 |
| Product Name: | SLC4A4 Antibody |
| Product Description: | Mouse Monoclonal anti-SLC4A4 (1G2) |
| Clone: | 1G2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8671 |
| Gene Symbol: | SLC4A4 |
| Omim ID: | 603345, 604278, |
| Immunogen: | SLC4A4 (AAH30977, 1 a.a. ~ 647 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSTENVEGKPSNLGERGRARSSTFLRVVQPMFNHSIFTSAVSPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEM
EWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPELKD
KVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRD
AEASNVLVGEVDFLDTPF |
| Specificity: | SLC4A4 - solute carrier family 4, sodium bicarbonate cotransporter, member 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Sodium bicarbonate cotransporters (NBCs) mediate the coupled movement of sodium and bicarbonate ions across the plasma membrane of many cells. This is an electrogenic process with an apparent stoichiometry of 3 bicarbonate ions per sodium ion. Sodium bicarbonate cotransport is involved in bicarbonate secretion/absorption and intracellular pH regulation. Romero and Boron (1999) [PubMed 10099707] reviewed NBCs. Soleimani and Burnham (2000) [PubMed 10652014] reviewed NBCs and their regulation in physiologic and pathophysiologic states.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp781H1314 antibody, anti-HNBC1 antibody, anti-KNBC antibody, anti-NBC1 antibody, anti-NBC2 antibody, anti-SLC4A5 antibody, anti-hhNMC antibody, anti-pNBC antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |