| request information: |
|
| Catalog Code: | H00008659-A01 |
| Product Name: | ALDH4A1 Antibody |
| Product Description: | Mouse Polyclonal anti-ALDH4A1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8659 |
| Gene Symbol: | ALDH4A1 |
| Omim ID: | 239510 606811 |
| Immunogen: | ALDH4A1 (AAH07581, 1 a.a. ~ 564 a.a) full length recombinant protein with GST tag. |
| Epitope: | MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQ
YQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQA
EIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDT
AMLASYAVYRILREAGLP |
| Specificity: | ALDH4A1 - aldehyde dehydrogenase 4 family, member A1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This protein belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline. Two transcript variants encoding the same protein have been identified for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ALDH4 antibody, anti-P5CD antibody, anti-P5CDh antibody, anti-P5CDhL antibody, anti-P5CDhS antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |