ExactAntigen

MAP2K1IP1 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00008649-A01
Product Name:MAP2K1IP1 Antibody
Product Description:Mouse Polyclonal anti-MAP2K1IP1
Clonality:Polyclonal
ListPrice:225
Gene ID:8649
Gene Symbol:MAP2K1IP1
Omim ID:603296,
Immunogen:MAP2K1IP1 (NP_068805, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag.
Epitope:MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQ
VVQFNRLP*
Specificity:MAP2K1IP1 - mitogen-activated protein kinase kinase 1 interacting protein 1
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Background:The protein encoded by this gene was identified as an interacting protein that binds specifically to MAP kinase kinase MAP2K1/MEK1 and to MAP kinase MAPK2/ERK1. This protein enhances the activation of MAPK2, and thus is thought to function as an adaptor to enhance the efficiency of the MAP kinase cascade.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-MP1 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human MAPKSP1 antibodies


2008©ExactAntigen home | browse | about