| request information: |
|
| Catalog Code: | H00008648-A01 |
| Product Name: | NCOA1 Antibody |
| Product Description: | Mouse Polyclonal anti-NCOA1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8648 |
| Gene Symbol: | NCOA1 |
| Omim ID: | 602691 |
| Immunogen: | NCOA1 (NP_003734, 284 a.a. ~ 394 a.a) partial recombinant protein with GST tag. |
| Epitope: | GRTGWEDLVRKCIYAFFQPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMGIH
IIDREHSGLSPQDDTNSGMSIPRVNPSVNPS* |
| Specificity: | NCOA1 - nuclear receptor coactivator 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene acts as a transcriptional coactivator for steroid and nuclear hormone receptors. It is a member of the p160/steroid receptor coactivator (SRC) family and like other family members has histone acetyltransferase activity and contains a nuclear localization signal, as well as bHLH and PAS domains. The product of this gene binds nuclear receptors directly and stimulates the transcriptional activities in a hormone-dependent fashion. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-F-SRC-1 antibody, anti-NCoA-1 antibody, anti-RIP160 antibody, anti-SRC1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |