| request information: |
|
| Catalog Code: | H00008626-M01 |
| Product Name: | TP73L Antibody |
| Product Description: | Mouse Monoclonal anti-TP73L (3C2) |
| Clone: | 3C2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8626 |
| Gene Symbol: | TP73L |
| Immunogen: | TP73L (AAH39815, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Epitope: | MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDE
PSEDGATNKIEISMDCIRMQD |
| Specificity: | TP73L - tumor protein p73-like |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a member of the p53 family of transcription factors. An animal model, p63 -/- mice, has been useful in defining the role this protein plays in the development and maintenance of stratified epithelial tissues. p63 -/- mice have several developmental defects which include the lack of limbs and other tissues, such as teeth and mammary glands, which develop as a result of interactions between mesenchyme and epithelium. Mutations in this gene are associated with ectodermal dysplasia, and cleft lip/palate syndrome 3 (EEC3); split-hand/foot malformation 4 (SHFM4); ankyloblepharon-ectodermal defects-cleft lip/palate; ADULT syndrome (acro-dermato-ungual-lacrimal-tooth); limb-mammary syndrome; Rap-Hodgkin syndrome (RHS); and orofacial cleft 8. Both alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different proteins. Many transcripts encoding different proteins have been reported but the biological validity and the full-length nature of these variants have not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-B(p51A) antibody, anti-B(p51B) antibody, anti-EEC3 antibody, anti-KET antibody, anti-LMS antibody, anti-RHS antibody, anti-SHFM4 antibody, anti-TP63 antibody, anti-p51 antibody, anti-p63 antibody, anti-p73H antibody, anti-p73L antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |