| request information: |
|
| Catalog Code: | H00008609-M01 |
| Product Name: | KLF7 Antibody |
| Product Description: | Mouse Monoclonal anti-KLF7 (3E8-B8) |
| Clone: | 3E8-B8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8609 |
| Gene Symbol: | KLF7 |
| Omim ID: | 604865, |
| Immunogen: | KLF7 (AAH12919, 1 a.a. ~ 231 a.a) full length recombinant protein with GST tag. |
| Epitope: | MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERY LQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPV EAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVN QAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVA KKAALSSVKVRSLISAHGRDVSGVLHEAMSSRGTTGNTQVQS PSNATTATGVFPGLTILPST* |
| Specificity: | KLF7 - Kruppel-like factor 7 (ubiquitous) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Localization: | Nuclear |
| Background: | KLF7 is a transcriptional activator. It binds in vitro to the CACCC motif of the beta-globin promoter and to the SP1 recognition sequence. It is ubiquitous and highly expressed at low levels in brain and spinal cord in the adult, and in kidney and brain in the embryo. The acidic N terminal part may favor interaction with the basic domain of transcription factors. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Krueppel like factor 7 antibody, anti-Kruppel like factor 7 antibody, anti-Ubiquitous krueppel like factor antibody, anti-UKLF antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |