ExactAntigen

KLF7 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00008609-A01
Product Type:Primary Antibody
Product Name:KLF7 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:8609
Host:Mouse
Product Description:Mouse Polyclonal anti-KLF7
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = 8609 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-UKLF antibody
Immunogen:KLF7 (AAH12919, 1 a.a. ~ 231 a.a) full length recombinant protein with GST tag.
Epitope:MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVRSLISAHGRDVSGVLHEAMSSRGTTGNTQVQSPSNATTATGVFPGLTILPST* ...
Specificity:KLF7 - Kruppel-like factor 7 (ubiquitous)
Purity:Whole antisera
Packaging:50 ul Whole antisera Mouse antisera.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<b
Application Summary:ELISA, WB
Product References:Catechin Suppresses Expression of Kruppel-like factor 7 and Increases Expression and Secretion of Adiponectin Protein in 3T3-L1 cells. Cho SY, et al. Am J Physiol Endocrinol Metab, Dec 2006; 10.1152/ajpendo.00436.2006.
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:KLF7
Omim ID:604865
see all human KLF7 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about