| request information: |
|
| Catalog Code: | H00008581-B01 |
| Product Name: | LY6D Antibody |
| Product Description: | Mouse Polyclonal anti-LY6D |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 8581 |
| Gene Symbol: | LY6D |
| Omim ID: | 606204, |
| Immunogen: | LY6D (AAH31330, 21 a.a. ~ 129 a.a) full-length human protein. |
| Epitope: | LRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNA
APTRTALAHSALSLGLALSLLAVILAPSL* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-E48 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |