| request information: |
|
| Catalog Code: | H00008576-M02 |
| Product Name: | STK16 Antibody |
| Product Description: | Mouse Monoclonal anti-STK16 (M2) |
| Clone: | M2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8576 |
| Gene Symbol: | STK16 |
| Omim ID: | 604719 |
| Immunogen: | STK16 (AAH02618,1 a.a. ~ 306 a.a) full length recombinant protein with GST tag. |
| Epitope: | MGHALCVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDREEAQREADMHRLFNHPNILR
LVAYCLRERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIHAKGYAHRDLKPTNILLGD
EGQPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYDM
VFQKGDSVALAVQNQLSI |
| Specificity: | STK16 - serine/threonine kinase 16 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin), RNAi validation and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot, RNAi Validation |
| Species Summary: | Hu |
| Alternate Names: | anti-FLJ39635 antibody, anti-KRCT antibody, anti-MPSK antibody, anti-PKL12 antibody, anti-TSF1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |