| request information: | |
| Catalog Code: | H00008570-M02 |
| Product Name: | KHSRP Antibody |
| Product Description: | Mouse Monoclonal anti-KHSRP (2C7) |
| Clone: | 2C7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8570 |
| Gene Symbol: | KHSRP |
| Omim ID: | 603445, |
| Immunogen: | KHSRP (NP_003676, 151 a.a. ~ 240 a.a) partial recombinant protein with GST tag. |
| Epitope: | VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANG GQNGTVQEIM* |
| Specificity: | KHSRP - KH-type splicing regulatory protein (FUSE binding protein 2) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FBP2 antibody, anti-FUBP2 antibody, anti-KSRP antibody, anti-MGC99676 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |