| request information: |
|
| Catalog Code: | H00008569-M12 |
| Product Name: | MAP kinase interacting serine Antibody |
| Product Description: | Mouse Monoclonal anti-MAP kinase interacting serine (3E10) |
| Clone: | 3E10 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8569 |
| Gene Symbol: | MKNK1 |
| Omim ID: | 606724, |
| Immunogen: | MKNK1 (AAH02755, 1 a.a. ~ 466 a.a) full length recombinant protein with GST tag. |
| Epitope: | MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQNGKEYAVKI
IEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAAL
DFLHTKDKVSLCHLGWSAMAPSGLTAAPTSLGSSDPPTSASQVAGTTGIAHRDLKPENILCESPEKVSPVKICDFDLGS
GMKLNNSCTPITTPELTT |
| Specificity: | MAP kinase interacting serine/threonine kinase 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MNK1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |