| request information: |
|
| Catalog Code: | H00008569-M08 |
| Product Name: | MKNK1 Antibody |
| Product Description: | Mouse Monoclonal anti-MKNK1 (2H8) |
| Clone: | 2H8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8569 |
| Gene Symbol: | MKNK1 |
| Omim ID: | 606724, |
| Immunogen: | MKNK1 (AAH02755, 1 a.a. ~ 466 a.a) full length recombinant protein with GST tag. |
| Epitope: | MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPG KFEDMYKLTSELLGEGAYAKVQGAVSLQNGKEYAVKIIEKQA GHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRFYLVFEK LQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVS LCHLGWSAMAPSGLTAAPTSLGSSDPPTSASQVAGTTGIAHR DLKPENILCESPEKVSPVKICDFDLGSGMKLNNSC |
| Specificity: | MKNK1 - MAP kinase interacting serine/threonine kinase 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Localization: | Isoforms 1 and 2 cytoplasmic, isoform 3 nuclear |
| Background: | MNK1 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MAP kinase interacting serine/threonine kinase 1 antibody, anti-MAP kinase signal integrating kinase 1 antibody, anti-MKNK1 antibody, anti-MNK 1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |