ExactAntigen

Mouse Polyclonal anti-MAP kinase interacting serine | Novus Biologicals antibody product information
CatalogCode:H00008569-A02
ProductName:MAP kinase interacting serine Antibody
Product Description:Mouse Polyclonal anti-MAP kinase interacting serine
Clonality:Polyclonal
Immunogen:MKNK1 (NP_003675, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope:MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQ* ...
Specificity:MAP kinase interacting serine/threonine kinase 1
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Other applications have not been tested.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-MNK1 antibody
ProteinTarget:MAP kinase interacting serine/threonine kinase 1
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:8569
Gene_Symbol:MKNK1
Omim_ID:606724,
order or
more information
:
company product webpage
request information:
Also see:
all human MKNK1 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about