ExactAntigen

Mouse Monoclonal anti-CDC14A (2C12)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00008556-M01
ProductName:CDC14A Antibody
Product Description:Mouse Monoclonal anti-CDC14A (2C12)
Clone:2C12
Clonality:Monoclonal
Immunogen:CDC14A (NP_003663, 431 a.a. ~ 531 a.a) partial recombinant protein with GST tag.
Epitope:PFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSRLASSLGNLNAATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPE* ...
Specificity:CDC14A - CDC14 cell division cycle 14 homolog A (S. cerevisiae)
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. It is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, suggesting a role in cell cycle control. This protein has been shown to interact with, and dephosphorylate tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splicing of this gene results in several transcript variants encoding distinct isoforms.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2b kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-Cdc14A1 antibody, anti-Cdc14A2 antibody, anti-cdc14 antibody, anti-hCDC14 antibody
ProteinTarget:CDC14A - CDC14 cell division cycle 14 homolog A (S. cerevisiae)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:8556
Gene_Symbol:CDC14A
Omim_ID:603504,
see all human CDC14A antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about