| request information: |
|
| Catalog Code: | H00008556-A01 |
| Product Name: | CDC14A Antibody |
| Product Description: | Mouse Polyclonal anti-CDC14A |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8556 |
| Gene Symbol: | CDC14A |
| Omim ID: | 603504 |
| Immunogen: | CDC14A (NP_003663, 431 a.a. ~ 530 a.a) partial recombinant protein with GST tag. |
| Epitope: | PFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSRLASSLGNLNAATDDPENKKTSSSSKAGFT
ASPFTNLLNGSSQPTTRNYPE* |
| Specificity: | CDC14A - CDC14 cell division cycle 14 homolog A (S. cerevisiae) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. It is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, suggesting a role in cell cycle control. This protein has been shown to interact with, and dephosphorylate tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splicing of this gene results in several transcript variants encoding distinct isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Cdc14A1 antibody, anti-Cdc14A2 antibody, anti-cdc14 antibody, anti-hCDC14 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |