| CatalogCode: | | H00008555-A01 |
| ProductName: | | CDC14B Antibody |
| Product Description: | | Mouse Polyclonal anti-CDC14B |
| Clonality: | | Polyclonal |
| Immunogen: | | CDC14B (NP_003662, 360 a.a. ~ 460 a.a) partial recombinant protein with GST tag. |
| Epitope: | | LVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTLSISRTKTVLR* ... |
| Specificity: | | CDC14B - CDC14 cell division cycle 14 homolog B (S. cerevisiae) |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | | The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-CDC14B3 antibody, anti-Cdc14B1 antibody, anti-Cdc14B2 antibody, anti-hCDC14B antibody |
| ProteinTarget: | | CDC14B - CDC14 cell division cycle 14 homolog B (S. cerevisiae) |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 8555 |
| Gene_Symbol: | | CDC14B |
| Omim_ID: | | 603505 H00008555-B01 |
| more information: | | company product webpage |