| request information: |
|
| Catalog Code: | H00008545-M02 |
| Product Name: | CGGBP1 Antibody |
| Product Description: | Mouse Monoclonal anti-CGGBP1 (1D11) |
| Clone: | 1D11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8545 |
| Gene Symbol: | CGGBP1 |
| Omim ID: | 603363, |
| Immunogen: | CGGBP1 (NP_003654, 58 a.a. ~ 168 a.a) partial recombinant protein with GST tag. |
| Epitope: | ISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKN
GGSIPKSDQLRRAYLPDGYENENQLLNSQDC* |
| Specificity: | CGGBP1 - CGG triplet repeat binding protein 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Background: | CGGBP1 influences expression of the FMR1 gene (MIM 309550), which is associated with the fragile X mental retardation syndrome (MIM 300624), by specifically interacting with the 5-prime (CGG)n-3-prime repeat in its 5-prime UTR.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CGGBP antibody, anti-p20-CGGBP antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |