| request information: |
|
| Catalog Code: | H00008538-A01 |
| Product Name: | BARX2 Antibody |
| Product Description: | Mouse Polyclonal anti-BARX2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8538 |
| Gene Symbol: | BARX2 |
| Omim ID: | 604823 |
| Immunogen: | BARX2 (NP_003649, 161 a.a. ~ 261 a.a) partial recombinant protein with GST tag. |
| Epitope: | PDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQGQEQLEPSQG
QEELCEAQEPKARDVPLEMAE* |
| Specificity: | BARX2 - BarH-like homeobox 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a member of the homeobox transcription factor family. A highly related protein in mouse has been shown to influence cellular processes that control cell adhesion and remodeling of the actin cytoskeleton in myoblast fusion and chondrogenesis. The encoded protein may also play a role in cancer progression. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |