| CatalogCode: | H00008536-M02 |
| ProductName: | calcium/calmodulin-dependent protein kinase I Antibody |
| Product Description: | Mouse Monoclonal anti-calcium/calmodulin-dependent protein kinase I (2B6) |
| Clone: | 2B6 |
| Clonality: | Monoclonal |
| Immunogen: | CAMK1 (NP_003647, 271 a.a. ~ 371 a.a) partial recombinant protein with GST tag. |
| Epitope: | LQHPWIAGDTALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGTELSPTLPHQL* ... |
| Specificity: | calcium/calmodulin-dependent protein kinase I |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG Mix Kappa |
| Host_Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CAMKI antibody, anti-MGC120317 antibody, anti-MGC120318 antibody |
| ProteinTarget: | calcium/calmodulin-dependent protein kinase I |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 8536 |
| Gene_Symbol: | CAMK1 |
| Omim_ID: | 604998, |
order or
more information: | company product webpage |
| request information: |
|