ExactAntigen

Mouse Monoclonal anti-calcium/calmodulin-dependent protein kinase I (2B6) | Novus Biologicals antibody product information
CatalogCode:H00008536-M02
ProductName:calcium/calmodulin-dependent protein kinase I Antibody
Product Description:Mouse Monoclonal anti-calcium/calmodulin-dependent protein kinase I (2B6)
Clone:2B6
Clonality:Monoclonal
Immunogen:CAMK1 (NP_003647, 271 a.a. ~ 371 a.a) partial recombinant protein with GST tag.
Epitope:LQHPWIAGDTALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGTELSPTLPHQL* ...
Specificity:calcium/calmodulin-dependent protein kinase I
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG Mix Kappa
Host_Name:Mouse
Buffer:1X PBS pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-CAMKI antibody, anti-MGC120317 antibody, anti-MGC120318 antibody
ProteinTarget:calcium/calmodulin-dependent protein kinase I
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:8536
Gene_Symbol:CAMK1
Omim_ID:604998,
order or
more information
:
company product webpage
request information:
Also see:
all human CAMK1 antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about