| request information: |
|
| Catalog Code: | H00008536-M01 |
| Product Name: | CAMK1 Antibody |
| Product Description: | Mouse Monoclonal anti-CAMK1 (3G1) |
| Clone: | 3G1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8536 |
| Gene Symbol: | CAMK1 |
| Omim ID: | 604998 |
| Immunogen: | CAMK1 (NP_003647, 271 a.a. ~ 371 a.a) partial recombinant protein with GST tag. |
| Epitope: | LQHPWIAGDTALDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGC
CCRDCCVEPGTELSPTLPHQL* |
| Specificity: | CAMK1 - calcium/calmodulin-dependent protein kinase I |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | Calcium/calmodulin-dependent protein kinase I is expressed in many tissues and is a component of a calmodulin-dependent protein kinase cascade. Calcium/calmodulin directly activates calcium/calmodulin-dependent protein kinase I by binding to the enzyme and indirectly promotes the phosphorylation and synergistic activation of the enzyme by calcium/calmodulin-dependent protein kinase I kinase. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CAMKI antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |