| request information: |
|
| Catalog Code: | H00008533-A01 |
| Product Name: | COPS3 Antibody |
| Product Description: | Mouse Polyclonal anti-COPS3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8533 |
| Gene Symbol: | COPS3 |
| Omim ID: | 604665 |
| Immunogen: | COPS3 (NP_003644, 324 a.a. ~ 423 a.a) partial recombinant protein with GST tag. |
| Epitope: | SRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQ
FVQKSMGSQEDDSGNKPSSY* |
| Specificity: | COPS3 - COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene possesses kinase activity that phosphorylates regulators involved in signal transduction. It phosphorylates I kappa-Balpha, p105, and c-Jun. It acts as a docking site for complex-mediated phosphorylation. The gene is located within the Smith-Magenis syndrome region on chromosome 17. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-SGN3 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |