| request information: |
|
| Catalog Code: | H00008531-M06 |
| Product Name: | CSDA Antibody |
| Product Description: | Mouse Monoclonal anti-CSDA (1H5) |
| Clone: | 1H5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8531 |
| Gene Symbol: | CSDA |
| Omim ID: | 603437, |
| Immunogen: | CSDA (NP_003642, 241 a.a. ~ 331 a.a) partial recombinant protein with GST tag. |
| Epitope: | HVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSG
PNQPSVRRGYR* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CSDA1 antibody, anti-DBPA antibody, anti-ZONAB antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |