| request information: |
|
| Catalog Code: | H00008528-A01 |
| Product Name: | DDO Antibody |
| Product Description: | Mouse Polyclonal anti-DDO |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8528 |
| Gene Symbol: | DDO |
| Omim ID: | 124450 |
| Immunogen: | DDO (NP_003640, 270 a.a. ~ 370 a.a) partial recombinant protein with GST tag. |
| Epitope: | WNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALE
AARLVSECVHALRTPIPKSNL* |
| Specificity: | DDO - D-aspartate oxidase |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against tissue lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene is a peroxisomal flavoprotein that catalyzes the oxidative deamination of D-aspartate and N-methyl D-aspartate. Flavin adenine dinucleotide or 6-hydroxyflavin adenine dinucleotide can serve as the cofactor in this reaction. Two transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DASOX antibody, anti-DDO-1 antibody, anti-DDO-2 antibody, anti-FLJ45203 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
| Product References: | 1. Huang AS, Lee DA, Blackshaw S. D-Aspartate and D-Aspartate Oxidase Show Selective and Developmentally Dynamic Localization in Mouse Retina. doi:10.1016/j.exer.2008.01.015 |
order or
more information: | company product webpage |