| request information: |
|
| Catalog Code: | H00008521-M04 |
| Product Name: | GCM1 Antibody |
| Product Description: | Mouse Monoclonal anti-GCM1 (4E8) |
| Clone: | 4E8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8521 |
| Gene Symbol: | GCM1 |
| Omim ID: | 603715, |
| Immunogen: | GCM1 (NP_003634, 108 a.a. ~ 166 a.a) partial recombinant protein with GST tag. |
| Epitope: | QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA* |
| Specificity: | GCM1 - glial cells missing homolog 1 (Drosophila) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GCMA antibody, anti-hGCMa antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |