| request information: |
|
| Catalog Code: | H00008518-M03 |
| Product Name: | IKBKAP Antibody |
| Product Description: | Mouse Monoclonal anti-IKBKAP (6G9) |
| Clone: | 6G9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8518 |
| Gene Symbol: | IKBKAP |
| Omim ID: | 223900, 603722, |
| Immunogen: | IKBKAP (NP_003631, 1242 a.a. ~ 1332 a.a) partial recombinant protein with GST tag. |
| Epitope: | VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKI
NRRTQWKLSLL* |
| Specificity: | IKBKAP - inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | The protein encoded by this gene is a scaffold protein and a regulator for 3 different kinases involved in proinflammatory signaling. This encoded protein can bind NF-kappa-B-inducing kinase (NIK) and IKKs through separate domains and assemble them into an active kinase complex. Mutations in this gene have been associated with familial dysautonomia. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp781H1425 antibody, anti-DYS antibody, anti-ELP1 antibody, anti-FD antibody, anti-IKAP antibody, anti-IKI3 antibody, anti-TOT1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |