| request information: |
|
| Catalog Code: | H00008517-A01 |
| Product Name: | IKBKG Antibody |
| Product Description: | Mouse Polyclonal anti-IKBKG |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8517 |
| Gene Symbol: | IKBKG |
| Omim ID: | 300248 300291 300301 308300 |
| Immunogen: | IKBKG (NP_003630, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEEL
LHFQASQREEKEFLMCKFQEARKLVERLGLE* |
| Specificity: | IKBKG - inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Familial incontinentia pigmenti (IP) is a genodermatosis that segregates as an X-linked dominant disorder and is usually lethal prenatally in males (The International Incontinentia Pigmenti Consortium, 2000 [PubMed 10839543]). In affected females it causes highly variable abnormalities of the skin, hair, nails, teeth, eyes, and central nervous system. The prominent skin signs occur in 4 classic cutaneous stages: perinatal inflammatory vesicles, verrucous patches, a distinctive pattern of hyperpigmentation, and dermal scarring. Cells expressing the mutated X chromosome are eliminated selectively around the time of birth, so females with IP exhibit extremely skewed X-inactivation. Familial incontinentia pigmenti is caused by mutations in the NEMO gene and is here referred to as IP2, or 'classical' incontinentia pigmenti. Sporadic incontinentia pigmenti, the so-called IP1, which maps to Xp11, is categorized as hypomelanosis of Ito (MIM 300337).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FIP-3 antibody, anti-FIP3 antibody, anti-Fip3p antibody, anti-IKK-gamma antibody, anti-IP antibody, anti-IP2 antibody, anti-NEMO antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |