| CatalogCode: | H00008513-M01 |
| ProductName: | LIPF Antibody |
| Product Description: | Mouse Monoclonal anti-LIPF (2E8) |
| Clone: | 2E8 |
| Clonality: | Monoclonal |
| Immunogen: | LIPF (NP_004181, 299 a.a. ~ 399 a.a) partial recombinant protein with GST tag. |
| Epitope: | KSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK* ... |
| Specificity: | LIPF - lipase, gastric |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-LIPF antibody, anti-lipase antibody, anti-gastric antibody, anti-GL antibody, anti-HGL antibody, anti-HLAL antibody, anti-MGC138477 antibody, anti-MGC142271 antibody, anti-gastric lipase antibody, anti-gastric triacylglycerol lipase antibody |
| ProteinTarget: | LIPF - lipase, gastric |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 8513 |
| Gene_Symbol: | LIPF |
| Omim_ID: | 601980, |
order or
more information: | company product webpage |
| request information: |
|