| request information: |
|
| Catalog Code: | H00008506-A01 |
| Product Name: | CNTNAP1 Antibody |
| Product Description: | Mouse Polyclonal anti-CNTNAP1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8506 |
| Gene Symbol: | CNTNAP1 |
| Omim ID: | 602346 |
| Immunogen: | CNTNAP1 (NP_003623, 22 a.a. ~ 132 a.a) partial recombinant protein with GST tag. |
| Epitope: | YYGCDEELVGPLYARSLGASSYYSLLTAPRFARLHGISGWSPRIGDPNPWLQIDLMKKHRIRAVATQGSFNSWDWVTRY
MLLYGDRVDSWTPFYQRGHNSTFFGNVNESA* |
| Specificity: | CNTNAP1 - contactin associated protein 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The gene product was initially identified as a 190-kD protein associated with the contactin-PTPRZ1 complex. The 1,381-amino acid protein, also designated p190 or CASPR for 'contactin-associated protein,' includes an extracellular domain with several putative protein-protein interaction domains, a putative transmembrane domain, and a 74-amino acid cytoplasmic domain. Northern blot analysis showed that the gene is transcribed predominantly in brain as a transcript of 6.2 kb, with weak expression in several other tissues tested. The architecture of its extracellular domain is similar to that of neurexins, and this protein may be the signaling subunit of contactin, enabling recruitment and activation of intracellular signaling pathways in neurons. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CASPR antibody, anti-CNTNAP antibody, anti-NRXN4 antibody, anti-P190 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |