| request information: |
|
| Catalog Code: | H00008503-A01 |
| Product Name: | PIK3R3 Antibody |
| Product Description: | Mouse Polyclonal anti-PIK3R3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8503 |
| Gene Symbol: | PIK3R3 |
| Omim ID: | 606076 |
| Immunogen: | PIK3R3 (AAH21622, 271 a.a. ~ 381 a.a) partial recombinant protein with GST tag. |
| Epitope: | HDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDEN
LPHYDEKTWFVEDINRVQAEDLLYGKPDGAF* |
| Specificity: | PIK3R3 - phosphoinositide-3-kinase, regulatory subunit 3 (p55, gamma) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp686P05226 antibody, anti-p55-GAMMA antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |