| Catalog Code: | H00008502-M02 |
| Product Type: | Primary Antibody |
| Product Name: | PKP4 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 8502 |
| Host: | Mouse |
| Clone: | 1B11 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-PKP4 (1B11) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Armadillo-like proteins are characterized by a series of armadillo repeats, first defined in the Drosophila 'armadillo' gene product, that are typically 42 to 45 amino acids in length. These proteins can be divided into subfamilies based on their number o |
| Alternate Names: | anti-p0071 antibody |
| Immunogen: | PKP4 (NP_001005476, 12 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | EGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQRLTRELEVERQIVASQLERCRLGAESPSIASTSSTEKSFPWRSTDVPNTGVSKPRVSDAVQ* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | PKP4 |
| Omim ID: | 604276, |