ExactAntigen

PKP4 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00008502-M02
Product Type:Primary Antibody
Product Name:PKP4 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:8502
Host:Mouse
Clone:1B11
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-PKP4 (1B11)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Armadillo-like proteins are characterized by a series of armadillo repeats, first defined in the Drosophila 'armadillo' gene product, that are typically 42 to 45 amino acids in length. These proteins can be divided into subfamilies based on their number o
Alternate Names:anti-p0071 antibody
Immunogen:PKP4 (NP_001005476, 12 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Epitope:EGQPQTRQEAASTGPGMEPETTATTILASVKEQELQFQRLTRELEVERQIVASQLERCRLGAESPSIASTSSTEKSFPWRSTDVPNTGVSKPRVSDAVQ* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:PKP4
Omim ID:604276,
see all human p0071 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about