| CatalogCode: | H00008498-M01 |
| ProductName: | RANBP3 Antibody |
| Product Description: | Mouse Monoclonal anti-RANBP3 (2E10) |
| Clone: | 2E10 |
| Clonality: | Monoclonal |
| Immunogen: | RANBP3 (AAH04349, 298 a.a. ~ 397 a.a) partial recombinant protein with GST tag. |
| Epitope: | KESLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWLLRHPHPSHPAVGPCLCGEQPALCPCPGLPNYRPGTPAQLGGLLVRV ... |
| Specificity: | RANBP3 - RAN binding protein 3 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DKFZp586I1520 antibody |
| ProteinTarget: | RANBP3 - RAN binding protein 3 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 8498 |
| Gene_Symbol: | RANBP3 |
| Omim_ID: | 603327 NB100-74647 |