ExactAntigen

Mouse Monoclonal anti-RANBP3 (2E10)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00008498-M01
ProductName:RANBP3 Antibody
Product Description:Mouse Monoclonal anti-RANBP3 (2E10)
Clone:2E10
Clonality:Monoclonal
Immunogen:RANBP3 (AAH04349, 298 a.a. ~ 397 a.a) partial recombinant protein with GST tag.
Epitope:KESLAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKTSQSWLLRHPHPSHPAVGPCLCGEQPALCPCPGLPNYRPGTPAQLGGLLVRV ...
Specificity:RANBP3 - RAN binding protein 3
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-DKFZp586I1520 antibody
ProteinTarget:RANBP3 - RAN binding protein 3
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:8498
Gene_Symbol:RANBP3
Omim_ID:603327 NB100-74647
see all human RANBP3 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about