| request information: |
|
| Catalog Code: | H00008490-A01 |
| Product Name: | RGS5 Antibody |
| Product Description: | Mouse Polyclonal anti-RGS5 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8490 |
| Gene Symbol: | RGS5 |
| Omim ID: | 603276, |
| Immunogen: | RGS5 (NP_003608, 94 a.a. ~ 182 a.a) partial recombinant protein with GST tag. |
| Epitope: | WIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVR
SEFYQELIK* |
| Specificity: | RGS5 - regulator of G-protein signalling 5 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-MST092 antibody, anti-MST106 antibody, anti-MST129 antibody, anti-MSTP032 antibody, anti-MSTP092 antibody, anti-MSTP106 antibody, anti-MSTP129 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |