| request information: |
|
| Catalog Code: | H00008483-M01 |
| Product Name: | CILP Antibody |
| Product Description: | Mouse Monoclonal anti-CILP (2C5) |
| Clone: | 2C5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8483 |
| Gene Symbol: | CILP |
| Omim ID: | 603489, 603932, |
| Immunogen: | CILP (NP_003604, 129 a.a. ~ 227 a.a) partial recombinant protein with GST tag. |
| Epitope: | NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTC
PMGQVNADCDACMCQDFML* |
| Specificity: | CILP - cartilage intermediate layer protein, nucleotide pyrophosphohydrolase |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage. The encoded protein was thought to encode a protein precursor for 2 different proteins, namely CILP and a homolog of NTPPHase, however later studies identified no nucleotide pyrophosphatase phosphodiesterase (NPP) activity. One isoform of the protein, CILP-1, functions as an IGF-1 antagonist. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-CILP antibody, anti-cartilage intermediate layer protein antibody, anti-nucleotide pyrophosphohydrolase antibody, anti-HGNC:1980 antibody, anti-HsT18872 antibody, anti-cartilage intermediate layer protein antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |