| request information: |
|
| Catalog Code: | H00008482-M01 |
| Product Name: | SEMA7A Antibody |
| Product Description: | Mouse Monoclonal anti-SEMA7A (3D3) |
| Clone: | 3D3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8482 |
| Gene Symbol: | SEMA7A |
| Omim ID: | 607961, |
| Immunogen: | SEMA7A (NP_003603, 536 a.a. ~ 634 a.a) partial recombinant protein with GST tag. |
| Epitope: | EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCE
AQEGSYFREAQHWQLLPED* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | SEMA7A is a membrane-bound semaphorin that associates with cell surfaces via a glycosylphosphatidylinositol (GPI) linkage. SEMA7A is also known as the John-Milton-Hagen (JMH) blood group antigen, an 80-kD glycoprotein expressed on activated lymphocytes and erythrocytes.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CD108 antibody, anti-CDw108 antibody, anti-H-SEMA-K1 antibody, anti-H-Sema K1 antibody, anti-H-Sema-L antibody, anti-JMH antibody, anti-MGC126692 antibody, anti-MGC126696 antibody, anti-SEMAK1 antibody, anti-SEMAL antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |