| CatalogCode: | H00008482-A01 |
| ProductName: | SEMA7A Antibody |
| Product Description: | Mouse Polyclonal anti-SEMA7A |
| Clonality: | Polyclonal |
| Immunogen: | SEMA7A (NP_003603, 536 a.a. ~ 634 a.a) partial recombinant protein with GST tag. |
| Epitope: | EPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPED* ... |
| Specificity: | SEMA7A - sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, (semaphorin) 7A |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | SEMA7A is a membrane-bound semaphorin that associates with cell surfaces via a glycosylphosphatidylinositol (GPI) linkage. SEMA7A is also known as the John-Milton-Hagen (JMH) blood group antigen, an 80-kD glycoprotein expressed on activated lymphocytes and erythrocytes.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-CD108 antibody, anti-CDw108 antibody, anti-H-SEMA-K1 antibody, anti-H-Sema K1 antibody, anti-H-Sema-L antibody, anti-SEMAK1 antibody, anti-SEMAL antibody |
| ProteinTarget: | SEMA7A - sema domain, immunoglobulin domain (Ig), and GPI membrane anchor, (semaphorin) 7A |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 8482 |
| Gene_Symbol: | SEMA7A |
| Omim_ID: | 607961 H00008482-M01 |
order or
more information: | company product webpage |
| request information: |
|