| request information: |
|
| Catalog Code: | H00008471-A01 |
| Product Name: | IRS4 Antibody |
| Product Description: | Mouse Polyclonal anti-IRS4 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8471 |
| Gene Symbol: | IRS4 |
| Omim ID: | 603510, |
| Immunogen: | IRS4 (NP_003595, 850 a.a. ~ 951 a.a) partial recombinant protein with GST tag. |
| Epitope: | DPKDAASKPSGEGSFSKPGDGGSPSKPSDHEPPKNKAKRPNRLSFITKGYKIKPKPQKPTHEQREADSSSDYVNMDFTK
RESNTPAPSTQGLPDSWGIIAE* |
| Specificity: | IRS4 - insulin receptor substrate 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Background: | IRS4 encodes the insulin receptor substrate 4, a cytoplasmic protein that contains many potential tyrosine and serine/threonine phosphorylation sites. Tyrosine-phosphorylated IRS4 protein has been shown to associate with cytoplasmic signalling molecules that contain SH2 domains. The IRS4 protein is phosphorylated by the insulin receptor tyrosine kinase upon receptor stimulation.. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-IRS-4 antibody, anti-PY160 antibody anti-IRS 4 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |