| CatalogCode: | H00008443-A01 |
| ProductName: | GNPAT Antibody |
| Product Description: | Mouse Polyclonal anti-GNPAT |
| Clonality: | Polyclonal |
| Immunogen: | GNPAT (NP_055051, 572 a.a. ~ 681 a.a) partial recombinant protein with GST tag. |
| Epitope: | LFKPFVESYQIICKYLLSEEEDHFSEEQYLAAVRKFTSQLLDQGTSQCYDVLSSDVQKNALAACVRLGVVEKKKINNNCIFNVNEPATTKLEEMLGCKTPIGKPATAKL* ... |
| Specificity: | GNPAT - glyceronephosphate O-acyltransferase |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | This gene encodes an enzyme located in the peroxisomal membrane which is essential to the synthesis of ether phospholipids. Mutations in this gene are associated with rhizomelic chondrodysplasia punctata. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-DAP-AT antibody, anti-DAPAT antibody, anti-DHAPAT antibody |
| ProteinTarget: | GNPAT - glyceronephosphate O-acyltransferase |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 8443 |
| Gene_Symbol: | GNPAT |
| Omim_ID: | 222765 602744 |