| request information: |
|
| Catalog Code: | H00008439-A01 |
| Product Name: | NSMAF Antibody |
| Product Description: | Mouse Polyclonal anti-NSMAF |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8439 |
| Gene Symbol: | NSMAF |
| Omim ID: | 603043 |
| Immunogen: | NSMAF (NP_003571, 818 a.a. ~ 918 a.a) partial recombinant protein with GST tag. |
| Epitope: | RHVLSTGTDGCLNVIDVQTGMLISSMTSDEPQRCFVWDGNSVLSGSQSGELLVWDLLGAKISERIQGHTGAVTCIWMNE
QCSSIITGGEDRQIIFWKLQY* |
| Specificity: | NSMAF - neutral sphingomyelinase (N-SMase) activation associated factor |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Cellular responses to tumor necrosis factor (TNF; MIM 191160) are initiated by the interaction of TNF with 2 distinct cell surface receptors that transmit signals to the cytoplasm and nucleus, leading to profound alterations in transcriptional programs. The initiation of intracellular signaling events through 1 of these receptors, the 55-kD tumor necrosis factor receptor-1 (TNFR1; MIM 191190), appears to depend on protein intermediates that interact with specific cytoplasmic domains of TNFR1 (Adam-Klages et al., 1996 [PubMed 8808629]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FAN antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |