| request information: |
|
| Catalog Code: | H00008424-A01 |
| Product Name: | BBOX1 Antibody |
| Product Description: | Mouse Polyclonal anti-BBOX1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8424 |
| Gene Symbol: | BBOX1 |
| Omim ID: | 603312, |
| Immunogen: | BBOX1 (NP_003977, 278 a.a. ~ 388 a.a) partial recombinant protein with GST tag. |
| Epitope: | IELDDKGQVVRINFNNATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGT
EISRHLEGAYADWDVVMSRLRILRQRVENGN* |
| Specificity: | Mouse polyclonal antibody raised against a partial recombinant BBOX1. |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to ELISA and Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500-1:1000 for polysera |
| Background: | This gene encodes gamma butyrobetaine hydroxylase which catalyzes the formation of L-carnitine from gamma-butyrobetaine, the last step in the L-carnitine biosynthetic pathway. Carnitine is essential for the transport of activated fatty acids across the mitochondrial membrane during mitochondrial beta-oxidation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-BBH antibody, anti-BBOX antibody, anti-GBBH antibody, anti-gammaBBH antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |