| request information: |
|
| Catalog Code: | H00008411-M02 |
| Product Name: | EEA1 Antibody |
| Product Description: | Mouse Monoclonal anti-EEA1 (1D4) |
| Clone: | 1D4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8411 |
| Gene Symbol: | EEA1 |
| Omim ID: | 605070, |
| Immunogen: | EEA1 (NP_003557, 1312 a.a. ~ 1412 a.a) partial recombinant protein with GST tag. |
| Epitope: | KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNA
LTPSSKKPVRVCDACFNDLQG* |
| Packaging: | 0.05 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Buffer: | 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu , Mu , Rt , |
| Alternate Names: | anti-early endosome antigen 1 antibody, anti-162kD antibody |
| Package Size: | 0.05 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|