| request information: |
|
| Catalog Code: | H00008396-A01 |
| Product Name: | PIP5K2B Antibody |
| Product Description: | Mouse Polyclonal anti-PIP5K2B |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8396 |
| Gene Symbol: | PIP5K2B |
| Omim ID: | 603261, |
| Immunogen: | PIP5K2B (NP_003550, 73 a.a. ~ 161 a.a) partial recombinant protein with GST tag. |
| Epitope: | AYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNSVTRSAPINSDSQGRCGTRFLTTYDRRFVIKT
VSSEDVAEM* |
| Specificity: | PIP5K2B - phosphatidylinositol-4-phosphate 5-kinase, type II, beta |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene catalyzes the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate. This gene is a member of the phosphatidylinositol-5-phosphate 4-kinase family. The encoded protein sequence does not show similarity to other kinases, but the protein does exhibit kinase activity. Additionally, the encoded protein interacts with p55 TNF receptor. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-PIP5KIIB antibody, anti-Pip4k2B antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |