ExactAntigen

HIST1H4H Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00008365-M01
Product Type:Primary Antibody
Product Name:HIST1H4H Antibody
List Price:275
Clonality:Monoclonal
Gene ID:8365
Host:Mouse
Clone:6D4
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-HIST1H4H (6D4)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = HIST1H4H PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-H4/h antibody, anti-H4FH antibody
Immunogen:HIST1H4H (NP_003534, 31 a.a. ~ 104 a.a) partial recombinant protein with GST tag.
Epitope:TKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG* ...
Specificity:HIST1H4H - histone 1, H4h
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:HIST1H4H
Omim ID:602828,
see all human HIST1H4H antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about