| request information: | |
| Catalog Code: | H00008347-A01 |
| Product Name: | HIST1H2BC Antibody |
| Product Description: | Mouse Polyclonal anti-HIST1H2BC |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8347 |
| Gene Symbol: | HIST1H2BC |
| Omim ID: | 602847 |
| Immunogen: | HIST1H2BC (1 a.a. ~ 127 a.a) full length recombinant protein with GST tag. |
| Epitope: | MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEAS RLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK* |
| Specificity: | HIST1H2BC - histone 1, H2bc |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H2B family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-H2B.1 antibody, anti-H2B/l antibody, anti-H2BFL antibody, anti-dJ221C16.3 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or more information: | company product webpage |