ExactAntigen

HIST2H2AA Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00008337-M01
Product Type:Primary Antibody
Product Name:HIST2H2AA Antibody
List Price:275
Clonality:Monoclonal
Gene ID:8337
Host:Mouse
Clone:4C10
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-HIST2H2AA (4C10)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = HIST2H2AA PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-H2A antibody, anti-H2A.2 antibody, anti-H2A/O antibody, anti-H2AFO antibody, anti-H2a-615 antibody
Immunogen:HIST2H2AA (AAH01629, 1 a.a. ~ 131 a.a) full length recombinant protein with GST tag.
Epitope:MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK* ...
Specificity:HIST2H2AA - histone 2, H2aa
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:HIST2H2AA
Omim ID:142720,
see all human HIST2H2AA3 antibodies
see all human HIST2H2AA4 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about