| CatalogCode: | | H00008323-A01 |
| ProductName: | | FZD6 Antibody |
| Product Description: | | Mouse Polyclonal anti-FZD6 |
| Clonality: | | Polyclonal |
| Immunogen: | | FZD6 (NP_003497, 71 a.a. ~ 182 a.a) partial recombinant protein with GST tag. |
| Epitope: | | PNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQC* ... |
| Specificity: | | FZD6 - frizzled homolog 6 (Drosophila) |
| CrossReactivity: | | Human. Other species not tested. |
| Packaging: | | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | | Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD6 protein contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, and 7 transmembrane domains. However, unlike many other Fz family members, FDZ6 does not contain a C-terminal PDZ domain-binding motif. |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | | Whole antisera |
| Host_Name: | | Mouse |
| ListPrice: | | 225 |
| AppSummary: | | ELISA, WB |
| SpeciesSummary: | | Hu |
| ALTnames: | | anti-Hfz6 antibody |
| ProteinTarget: | | FZD6 - frizzled homolog 6 (Drosophila) |
| PackageSize: | | 0.05 ml |
| NotesMain: | | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | | 8323 |
| Gene_Symbol: | | FZD6 |
| Omim_ID: | | 603409 H00008325-A01 |
| more information: | | company product webpage |