| CatalogCode: | H00008322-A01 |
| ProductName: | FZD4 Antibody |
| Product Description: | Mouse Polyclonal anti-FZD4 |
| Clonality: | Polyclonal |
| Immunogen: | FZD4 (NP_036325, 107 a.a. ~ 207 a.a) partial recombinant protein with GST tag. |
| Epitope: | TEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGY* ... |
| Specificity: | FZD4 - frizzled homolog 4 (Drosophila) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-EVR1 antibody, anti-FZD4S antibody, anti-Fz-4 antibody, anti-FzE4 antibody, anti-GPCR antibody, anti-MGC34390 antibody |
| ProteinTarget: | FZD4 - frizzled homolog 4 (Drosophila) |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 8322 |
| Gene_Symbol: | FZD4 |
| Omim_ID: | 133780 604579 |